Skip to content

Thetaslifestyle

Fashion and Lifestyle

Tag: experience

My TikTok FYP Made Me Buy it! – Trying Wellness Products I Bought Online

My TikTok FYP Made Me Buy it! – Trying Wellness Products I Bought Online

May 3, 2025 Posted in UncategorizedLeave a comment

Hello Readers! It’s been a year since I last posted; crazy, but I needed a break. Plus, time flew by so fast that I can not believe we’re halfway through the year!

beautydietexperiencefitnessFoodhealthhealthandfitnesslifestyleskincare
I Tried Using The Lemon 8 App – Is It Legit?

I Tried Using The Lemon 8 App – Is It Legit?

September 2, 2023September 1, 2023 Posted in beauty, fashion, Food, lifestyle, reviewsLeave a comment

Disclaimer: This is not a sponsored blog post but an honest review from a lifestyle blogger.

experiencefitnessFoodhealthandfitnesslemon 8lemon 8 applifestylerecipesreviewreviewssocial media
Getting back into fitness after a long break can be… difficult

Getting back into fitness after a long break can be… difficult

June 20, 2023June 20, 2023 Posted in Health and Fitness, storiesLeave a comment

Hellooo. I’m back again! I promised to publish my blog posts weekly after my previous post in January but I didn’t.

blogbodyfatdietexerciseexperiencefitnesshealthhealthandfitnesshealthylifestyleupdateweightweightlossworkoutworkouts
Where have I been?

Where have I been?

January 22, 2023 Posted in lifestyle, storiesLeave a comment

Hello, If you’re wondering why I haven’t posted actual content since March last year, well, I’m here to tell you.

experiencelifestyle
Trying Oppserve 3 Weeks Brand New Me Challenge

Trying Oppserve 3 Weeks Brand New Me Challenge

March 6, 2022March 5, 2022 Posted in Health and Fitness, lifestyle2 Comments

Hello Readers! Happy very late new year and I know I’ve been gone for some time but at least I’m back.

blogexerciseexperiencefitnesshealthhealthandfitnesshealthandnutritionhealthylifestylereviewweightweightlossworkoutworkouts
I followed Jeon Somi’s Strict Workout Routine for a Week  – Did I See Results?

I followed Jeon Somi’s Strict Workout Routine for a Week – Did I See Results?

December 5, 2021December 5, 2021 Posted in Food, Health and Fitness, lifestyle, reviewsLeave a comment

Warning: This blog post is for experimental purposes and If this triggers you in any way, don’t read the rest and click off. Hello,

#Jeonsomi#somiasiandietexerciseexperiencefitnessFoodhealthhealthandfitnesshealthyrecipekoreandietkpoplifestylemealsreviewworkoutworkouts
To The Person Who’ve Never Been Loved Before

To The Person Who’ve Never Been Loved Before

February 6, 2021February 6, 2021 Posted in Uncategorized1 Comment

Hello Readers, Long time right? I haven’t been blogging a lot recently and it’s because of university and a screenplay I’ve been doing since November.

2021experiencehopeletterlifelifestylelockdownlovepandemicpersonalblogrelationshipssadnesssinglevalentinesday
I Temporarily Stopped Eating Meat and Here’s Why

I Temporarily Stopped Eating Meat and Here’s Why

August 24, 2020August 23, 2020 Posted in Food, lifestyle, stories3 Comments

When I visited my sister’s place for the weekend, my sister and I wanted to order a takeaway for us to enjoy.

beefburgerdietexperienceFoodhealthhealthylifestylemeatweekend

My blog announcement

April 14, 2020 Posted in Uncategorized1 Comment

Hi, On 19th May 2020, I finally decided to upgrade my blog which means i will have a domain name! My blog layout will change so it looks more presentable than my current one. Instead of seeing random and questionable ads on my blog, you’ll see ads that are suitable to you and my niche!… Continue reading My blog announcement

announcementbloggerexperiencelifestyle
Sharifah

Sharifah

Hi! My name is Sharifah and I'm a 24-year-old lifestyle blogger who lives near London. I've been blogging for almost 9 years, which is crazy to me! Hope you enjoy reading my blog posts :)

View Full Profile →

January 2026
M T W T F S S
 1234
567891011
12131415161718
19202122232425
262728293031  
« May    

Top Posts & Pages

  • Top 10 female vloggers
    Top 10 female vloggers
  • Taste Test: Q2HAN'S Oatmeal Cookies Recipe
    Taste Test: Q2HAN'S Oatmeal Cookies Recipe
  • OOTW: September 2017 
    OOTW: September 2017 
  • TAS INTERVIEWS: Jenny Yu
    TAS INTERVIEWS: Jenny Yu
Blog at WordPress.com. Thetaslifestyle
Privacy & Cookies: This site uses cookies. By continuing to use this website, you agree to their use.
To find out more, including how to control cookies, see here: Cookie Policy
  • Subscribe Subscribed
    • Thetaslifestyle
    • Join 221 other subscribers
    • Already have a WordPress.com account? Log in now.
    • Thetaslifestyle
    • Subscribe Subscribed
    • Sign up
    • Log in
    • Report this content
    • View site in Reader
    • Manage subscriptions
    • Collapse this bar